PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g51961.5.p
Common NameBRADI_1g51961, LOC100837447
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 1272aa    MW: 143029 Da    PI: 6.995
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g51961.5.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.19.7e-191763147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                      +g+WT+eEd+ll+d++  +G+ +W++Iar  g++Rt+k+c++rw++ 
  Bradi1g51961.5.p 17 KGPWTPEEDKLLIDYIGAHGSCRWNSIARLAGLNRTGKSCRLRWLNC 63
                      79******************************************996 PP

2Myb_DNA-binding51.13.1e-1670115148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       r  +T +E++ll++++  lG++ W+ I  +m+ gRt++++k++w+++l
  Bradi1g51961.5.p  70 RVHFTDDEEKLLINLHSSLGNK-WSEIGTHMP-GRTDNEIKNYWNTHL 115
                       5679******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.2721264IPR017930Myb domain
SuperFamilySSF466896.25E-2915111IPR009057Homeodomain-like
SMARTSM007172.8E-151666IPR001005SANT/Myb domain
PfamPF002494.5E-171763IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.1E-231871IPR009057Homeodomain-like
CDDcd001678.82E-121962No hitNo description
PROSITE profilePS5129425.0765119IPR017930Myb domain
SMARTSM007172.6E-1569117IPR001005SANT/Myb domain
PfamPF002492.5E-1470115IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.5E-2372119IPR009057Homeodomain-like
CDDcd001671.04E-1173115No hitNo description
CDDcd147983.17E-7285363No hitNo description
SuperFamilySSF525404.96E-52470745IPR027417P-loop containing nucleoside triphosphate hydrolase
Gene3DG3DSA:3.40.50.3005.7E-14483658IPR027417P-loop containing nucleoside triphosphate hydrolase
PfamPF009313.0E-50501769IPR002182NB-ARC
PRINTSPR003642.8E-11506521No hitNo description
PRINTSPR003642.8E-11580594No hitNo description
PRINTSPR003642.8E-11677691No hitNo description
SuperFamilySSF520581.58E-188141199IPR032675Leucine-rich repeat domain, L domain-like
Gene3DG3DSA:3.80.10.108.0E-68841015IPR032675Leucine-rich repeat domain, L domain-like
PRINTSPR003642.8E-11939955No hitNo description
Gene3DG3DSA:3.80.10.108.0E-610831123IPR032675Leucine-rich repeat domain, L domain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0043531Molecular FunctionADP binding
Sequence ? help Back to Top
Protein Sequence    Length: 1272 aa     Download sequence    Send to blast
MGRSPAAPRY DGDSFKKGPW TPEEDKLLID YIGAHGSCRW NSIARLAGLN RTGKSCRLRW  60
LNCLQPDIKR VHFTDDEEKL LINLHSSLGN KWSEIGTHMP GRTDNEIKNY WNTHLSKKLP  120
AGIVKASCGA GSSSYIQAHP GPSQLFDFST SFDVGHGSGS SIQAGPARFL DFSTSSDFGA  180
GSSSFIQGFQ ADPDLSIFDF SSAGKHTDLL SDVNPHAILE DPPDLDKFYF SPFSGSSSLS  240
IKADPAQPPS SSFSTASGIV LDESACVSSS DISALFDDSV SSSSGAMRPL VGKLSMLLEG  300
SVSISKRVKD GMHLLKDDVE DITSYLDELS RLEDPPPMAK CWMNEVRDLS YDMEDYIDTL  360
LFERPDHLNK NKMKNKKNKL TSHVKIPKRL KCCNCKQTKL KHGKTRWVCR NIHHIFINNR  420
LSKRPRNIGA PEMISDFRKY LQDAIERHDR YKLHCCSTLR HRFLSSGRML PTPYEEAAQI  480
VMDDRTETFI NSLVSNDAAD QQQLKVASVL GSGCLGKTTL ANVLYNRIGM QFDCRAFIRV  540
PKNPDMKRLF HDLFSQLHHK KQPLPANCNE LGISDNINNY LQDKRYLIVI DGLWDASVWD  600
IIKYAFPKGN RGSRVITTTR IEDVALTCCC DNSEHVFEMK PLDDEHSRKL FFNRLFGSES  660
SCPKEFKQVS DEIVDMCGGL PLAIINIASH LANQQKAVSM DLLIYIRDSL RSDLRSNSTS  720
ERTRQVLNIS YNNLPDCLKT CLLYLGMYSE GSILSKDDLV KQWVAEGFTA REWKEQDQDM  780
MERAAGNYFS ELIDRRFIQP TYTDYSNKVV SCMVHDMVRD LIAQKSAEQN FIVVVDYNRK  840
NIALSHKVRR LSLHFGEARY AKTPANIRKS QVRSLGFFGL LECMPCIGEF KVLRVLNLQL  900
SGCPGDHDHI DLTGISELLQ LRYLKIESDV CIKLPNNMRR LQCLETLDIM GATRLAAVPW  960
DIINLPHLLH LSLPVDTKLL NWIGSMSVTV ISQWSLGKLE YLQDLHVTIS SANLSCDPES  1020
CEGIGMIALR SLLEGHVNLK TVVLAHGSSA KNDSNVFTPW DDMVFPPLVQ RFECSPDCSR  1080
FSRIPLGVRN LRNLCILRIS VRGLDISCLG ILRSLPALTA LSLCLQMAPT DEIIFDKAGF  1140
SVLKYFKLRF MIGIASLKFD ADAMPDLWKL KLVFDDIPEI DHQRDTPTIS IEHMPGLKEI  1200
SAKFGGAASD LEYASRNIIS NHPRNPTINM QLVAYSSVVD GSTKQKQEPD DIMEEPYDIR  1260
EQPDEYIQQE I*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-281511925128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014752342.10.0PREDICTED: putative disease resistance RPP13-like protein 3 isoform X1
RefseqXP_010228126.10.0PREDICTED: putative disease resistance RPP13-like protein 3 isoform X1
RefseqXP_014752341.10.0PREDICTED: putative disease resistance RPP13-like protein 3 isoform X1
TrEMBLA0A0Q3S4970.0A0A0Q3S497_BRADI; Uncharacterized protein
STRINGMLOC_64708.10.0(Hordeum vulgare)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G10280.11e-46myb domain protein 92